PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100278270001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family ZF-HD
Protein Properties Length: 69aa    MW: 7803.97 Da    PI: 9.1339
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100278270001genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer92.24.6e-291567356
                   ZF-HD_dimer  3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRre 56
                                   v+Y+eC+kNhAas+G +avDGC+Efmp+ ge+g+ aa++CaAC+CHRnFH++ 
  Ote100278270001|100278270001 15 LVTYEECRKNHAASIGKYAVDGCCEFMPA-GEKGSGAAFRCAACNCHRNFHKKV 67
                                  589*************************9.999*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047701.9E-271667IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257743.0E-151666IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015668.5E-251766IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152324.3961867IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Sequence ? help Back to Top
Protein Sequence    Length: 69 aa     Download sequence    Send to blast
MTQHKERKID SKERLVTYEE CRKNHAASIG KYAVDGCCEF MPAGEKGSGA AFRCAACNCH  60
RNFHKKVVR
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010246148.12e-25PREDICTED: mini zinc finger protein 2-like
RefseqXP_010653170.17e-25PREDICTED: mini zinc finger protein 2-like
SwissprotQ9SB618e-21ZHD2_ARATH; Zinc-finger homeodomain protein 2
TrEMBLA0A022RI986e-34A0A022RI98_ERYGU; Uncharacterized protein (Fragment)
STRINGVIT_08s0056g01130.t012e-24(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11052486